SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326317598|ref|YP_004235270.1| from Acidovorax avenae subsp. avenae ATCC 19860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326317598|ref|YP_004235270.1|
Domain Number 1 Region: 28-211
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-48
Family Methylesterase CheB, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 304-495
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.1e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1221-1390
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-42
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 4 Region: 875-1002
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.09e-32
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.083
Further Details:      
 
Domain Number 5 Region: 1416-1531
Classification Level Classification E-value
Superfamily CheY-like 4.55e-29
Family CheY-related 0.0029
Further Details:      
 
Domain Number 6 Region: 1000-1127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.45e-25
Family Heme-binding PAS domain 0.021
Further Details:      
 
Domain Number 7 Region: 1153-1233
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000824
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 8 Region: 234-305
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000000994
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0046
Further Details:      
 
Domain Number 9 Region: 782-887
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000228
Family Flavin-binding PAS domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|326317598|ref|YP_004235270.1|
Domain Number - Region: 564-652
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0067
Family Heme-binding PAS domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326317598|ref|YP_004235270.1|
Sequence length 1534
Comment signal transduction histidine kinase with CheB and CheR activity [Acidovorax avenae subsp. avenae ATCC 19860]
Sequence
MDEITPGPAEEAEAGAANGCAASGGAGLPVVGLGGSAGAIQALRDFFAAMPASPGMAFVV
VLHLSPDHESMLAELLQRATKLRVQQVTGAVTMEADTVYVVPPRKILEVHDGAIALAPLP
PDRQQHVAVDLLFRTLADSHGTRATAIVLSGADGDGAIGIKRIKERGGLTIAQDPGEAYA
SGMPGSAIATGMIDWVLPAAQMAARVMEYHRMAPRLHLAPPHGTEPPASGGDAADDEAAL
REVLALLRHRTGRDFGDYKRATVVRRVGRRMQVNGIGTMSGYLDCLRTRPGESGALLQDL
LISVTNFFRDPVAFAALESHLPQLFQGKTGADTLRVWVAGCATGEEAYSIAMLLAEYART
LDTAPVLQIFATDLDDAAIRAARDGFYPAAIESDVSAERLRRFFVRERGGYRVRRELRES
VLFAVHDLLRDSPFSRLDLISCRNLLIYLNREAQHRVLDTFHFALLPGKLLFLGSAESVD
DGDTRFSVIDKLHRLYGHQTSAHPDLLRPGGLAPAAAALHAQHAAHQGPVVHAGAMVPYF
ADTERPPAQAAGEKALPWGEVHLRLLEQLAPPSILVDGEQNILHMSPSAGRFLVFHGGEP
SRNLMRLIHPALRIELRAALYRAGRTGQPMRLAATPVDAAGGRVRVAPEVRPVPELGPGL
ALVLLQMLPELPAAHHLAAEVPQDTAAEQLDRELELLNAQLRSTIEQYEASTEELRASNE
ELQAMNEELRSATEELETNREELQSINEELTTVNHELKSKVDELGHANSDMQNLMDATAI
ATVFLDRDLRITRFTPSAVTLFNLIATDVGRPLSHLRTQLQYPELSEDARRVLERLALVE
REVGASDGNWYLVRMLPYRTLDDRIAGVVLTFVDISERKQGQEALRRSEDRFSAIVNQAV
VGVVQTELDGHITFVNRHYSHMLGYGHDELIGTQLLDLIHPADRQLSAHLMRRLAEHGEP
FHIEKRCLRKDGSTLWLHNSVSYLADAHGGPTASIVVCNDISERKRAENALRESTERLRL
VIENAVEYAIFSTDLDRRITTWNSGAERILGYSENEAVGQLADMIFTPEDRAAGAPLSET
STALATGGALDDRLHQRKDGSRFWASGALMPMHDDADTVVGFVKILRDQSDQRASQQALE
QSRADLLKALRENEEARAALQAADATKDRFLAVLSHELRNPLASIAGASAVLATEGAATG
DRDQAARIVQRQARAMAVLLDDLMDLSRLRLGRMVLQQREVPLDEIVEAALEATLGAIRA
AGHDFVQELPADTVMLLADPVRIAQVLANLLSNAAKYTPDHGRIRLSAWTEGGSIYLRVE
DNGIGMDPETVDDMFTMFSQSPDAGMRHTQGLGIGLALVRNIVEMHQGTVRGESAGPGQG
SRFTVQLPLPAQRSADGAARAQVPDEGVSASAPVPSVLLADDNVDVTWSISHLLEGCTVA
TAADGHEALRKARELGPDVAVLDLGMPGLDGISVARALRADPAGARMLLVAATGWGQDHN
REQAREAGFDAYMVKPLDVRELQRLIQAHMRSRG
Download sequence
Identical sequences F0Q3Z4
WP_013595197.1.49867 gi|326317598|ref|YP_004235270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]