SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326319050|ref|YP_004236722.1| from Acidovorax avenae subsp. avenae ATCC 19860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326319050|ref|YP_004236722.1|
Domain Number 1 Region: 169-357
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.05e-71
Family Methylesterase CheB, C-terminal domain 0.000000279
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily CheY-like 6.55e-28
Family CheY-related 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326319050|ref|YP_004236722.1|
Sequence length 366
Comment response regulator receiver modulated CheB methylesterase [Acidovorax avenae subsp. avenae ATCC 19860]
Sequence
MSRKIRVIVVDDSALVRSLLSEIINRQHDMECIGTANDPLIAREMIREMNPDVITLDVEM
PRMDGIDFLGRLMRLRPMPVVMISTLTERGAEVTMKALELGAVDFVAKPRVGLSSGLNEL
AAQIVDKIRVAAVAQVRRAPAPRPAEKAAQPGAAAPIAPAATLLGRLSTEKLICIGASTG
GTEAIREVLVQMPADSPAIVITQHMPPGFTTSFAARLNGLCQITVKEAVNGERILPGHAY
IAPGGKQFHVARSGANYVAVVDDGPPVNRHKPSVEVLFKSAAAVVGKNAFGVMLTGMGND
GAAAMREMKDAGSYNYVQDEASCIVFGMPREAIAHGAADEVLPLTQIAPALITRLRGATD
RLHHRI
Download sequence
Identical sequences F0Q6U7
gi|326319050|ref|YP_004236722.1| WP_013596627.1.49867 WP_013596627.1.92537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]