SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326315485|ref|YP_004233157.1| from Acidovorax avenae subsp. avenae ATCC 19860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326315485|ref|YP_004233157.1|
Domain Number 1 Region: 103-248
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.7e-30
Family PA2201 C-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326315485|ref|YP_004233157.1|
Sequence length 249
Comment hypothetical protein Acav_0667 [Acidovorax avenae subsp. avenae ATCC 19860]
Sequence
MRDNKKAAGYFADNISFSTKAMLKRFQDTEEFPRVEGRPGRAHDLVLYALQIVILRYSAG
DEIQAIKASVLQWIEARELQQRVLAPLPPKHEDKAMYERITLDTVYDALTMMAFGKALHF
NASEMKRLINAIGHPGEDALIDEGARALGDAQRPVAEACKFPKVYDPLLEVWRCDPSERP
AKLLAFSKVWKKKIKPIYWSDSLNGADGAYFGYWCFDVALAAIALDIPDEALRDNPYYPK
DLVDAARAK
Download sequence
Identical sequences F0Q731
WP_013593145.1.49867 gi|326315485|ref|YP_004233157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]