SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189501827|ref|YP_001957544.1| from Candidatus Amoebophilus asiaticus 5a2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189501827|ref|YP_001957544.1|
Domain Number 1 Region: 57-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.44e-24
Family Ribosomal protein L9 C-domain 0.00046
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.09e-17
Family Ribosomal protein L9 N-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189501827|ref|YP_001957544.1|
Sequence length 149
Comment hypothetical protein Aasi_0397 [Candidatus Amoebophilus asiaticus 5a2]
Sequence
MEIILKQDFKGLGYKNEIVKVKPGYARNYLIPQGFALVANETNKKIAQENAKQMAHKMAK
RKQDAESIANRLSQLAIKIKAKVGEKGKIFGAITPIQIADALKEQTGYIADRRDISFEKP
IKTLGTHKAIIKLHKEVVLTLSFEVIAEE
Download sequence
Identical sequences B3ERG3
WP_012472576.1.36742 gi|189501827|ref|YP_001957544.1| 452471.Aasi_0397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]