SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189502008|ref|YP_001957725.1| from Candidatus Amoebophilus asiaticus 5a2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189502008|ref|YP_001957725.1|
Domain Number 1 Region: 222-574
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.07e-79
Family beta-Lactamase/D-ala carboxypeptidase 0.00064
Further Details:      
 
Domain Number 2 Region: 51-233
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.41e-23
Family Penicillin binding protein dimerisation domain 0.0071
Further Details:      
 
Domain Number 3 Region: 649-704
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000034
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189502008|ref|YP_001957725.1|
Sequence length 704
Comment hypothetical protein Aasi_0595 [Candidatus Amoebophilus asiaticus 5a2]
Sequence
MDAKQTILLRTRIAFLGLFVFAVAVVAKLIHIQFVQGKKWTKLAQVATLEYRPIQPSRGN
IYAQDGNLLATSLPFYKVAIDPCIADNELFESNIKLLSTLLAEFYQDKPAQAYYELLCEA
RRNRKRYLLLNNKQITHHDKRKMSEWPIFREGRFRGGVIFEKTEKRFKPFRELAARTLGF
VNKNGNGVGLECSFDQILRGVEGGAVYQKLTGGSWKMIQSSNTKKPINGYDLITTLDINL
QDVAHTSLLKVLQQSQANYGAVVVMEVATGEIKAMVNLGSVAPGQYQEIYNYAAGSQGTT
EPGSIFKLVSMLALLEESNLELTDTVDTGEGKYKFHNLTMSDVKRGGHGIITVQEAFEQS
SNIGIAKLIDNTFSEKPQKFIDYIRQLGLDKPLGIQLQGEGIPFIKHPKHRAWTKVTLPW
MSMGYEVKLAPLQLLTVYNAIANQGKMLKPILVKEIRYANRTIETYTSTVLNKKICSDQT
LKKLQTMLEGVVERGTAKKFKHGFYKIAGKSGTSNKIKNGKYSDATYASFVGYFPADKPR
YSCIVVIDDPQGTEYHYGGQVAAPVVKEIANKLSAKDLVSAPYIRPIHSTEWHTPLPKFR
VAYKDDWQVTIQTLGINFPSPLNSDEWLQVIQQEEETIWKPYSNFSTSQVPRVVGMPLRD
ALFLLESRGLQVTLQGYTDGYVKAQSLTPGTQVKPGQTITLELN
Download sequence
Identical sequences B3ERZ4
WP_012472762.1.36742 gi|189502008|ref|YP_001957725.1| 452471.Aasi_0595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]