SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189502540|ref|YP_001958257.1| from Candidatus Amoebophilus asiaticus 5a2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189502540|ref|YP_001958257.1|
Domain Number 1 Region: 12-212
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.35e-52
Family PP-loop ATPase 0.0000245
Further Details:      
 
Domain Number 2 Region: 349-443
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.19e-17
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189502540|ref|YP_001958257.1|
Sequence length 454
Comment hypothetical protein Aasi_1198 [Candidatus Amoebophilus asiaticus 5a2]
Sequence
MTYKYKHINLTEGFISFINDHQLLQAEEPVLLAVSGGVDSVVMCSLFHEARLHFAIAHCN
FGLRGQESEEDEAFVHTLAQQYQVEFFTKRFNTKAYAKTNKLSTQMAARELRYAWFKELC
NIHQIDKLATAHHANDCLETVLFNLTKGTSIAGLHGILPKQNNLIRPLLFASKENLLQYA
QAKGLSWREDSSNKQDDYARNLIRHQVIPSLKLINPNLESTTNLTIDRLSQVEKLFNEQL
ENIRKEIFFQQEDIHYILIQKIKEKPWAAVALWELLKPFGFNFLQIKNLLHPSVQIGKSV
YVDNYQLYVDRTTWMLTDRKQTTVTSKHIANEKIKNINFLGKNLQLQVIPKEIYQITHTN
EIAALDLDKLQFPLTIRSWQTGDFFYPLGMLKRKKLSDFLIDQKVPLVLKQKVCVLESKG
QIVWVIGYRIDDRFKITDTTKQIYELQLTSFSKS
Download sequence
Identical sequences B3ETH6
452471.Aasi_1198 WP_012473280.1.36742 gi|189502540|ref|YP_001958257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]