SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|203288618|ref|YP_002223525.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|203288618|ref|YP_002223525.1|
Domain Number - Region: 2-121
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0123
Family DNA repair protein MutS, domain III 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203288618|ref|YP_002223525.1|
Sequence length 127
Comment hypothetical protein BDU_1122 [Borrelia duttonii Ly]
Sequence
MLNKTNTELGLIVLKNLIEFFVYSDTQDDELFQTGIKKVIDIYKYMNNIYTRSLQKMEMK
ESKQIVLELETILSKIAKLIDAINTNADTTLIEDLRFERNNLIEIKTKLLQEELDKINSK
NKKGGQK
Download sequence
Identical sequences B5RNH7
gi|203288618|ref|YP_002223525.1| WP_012539451.1.78452 gi|203288618|ref|YP_002223525.1|NC_011247 412419.BDU_1122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]