SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|203283985|ref|YP_002221725.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203283985|ref|YP_002221725.1|
Domain Number 1 Region: 38-183
Classification Level Classification E-value
Superfamily CBS-domain pair 7.45e-37
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 177-256
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-21
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203283985|ref|YP_002221725.1|
Sequence length 259
Comment hemolysin [Borrelia duttonii Ly]
Sequence
MMFKFFNFKNKKMKYVEGKDSEEKSRFETSLLNNFNSLKETIVKEIMVPRISVIFIDYSV
SKDDILKVVTSSNHSRFPVYKETIDDIIGIIHTKDILLHMWKKDFYDIDLKDIMRKVMFV
PESKKIDSLLKEFQENHVHIAIVVDEYGGISGLVTLEDILEEIVGDIQDEFDNEVDEIVP
LDDGSYLCTARVLIEDLNEKLGLCLPDGDFDTLGGFVYDLFGRIPLKNEKIEYNNLIFTI
KNMHQRNIKVIKISQKEGL
Download sequence
Identical sequences B5RKV8 B5RQN8 W5SGV3 W6TYB9
gi|203287528|ref|YP_002222543.1| 412418.BRE_62 412419.BDU_63 gi|203283985|ref|YP_002221725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]