SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209558891|ref|YP_002285363.1| from Streptococcus pyogenes NZ131

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209558891|ref|YP_002285363.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily CutC-like 3.66e-57
Family CutC-like 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209558891|ref|YP_002285363.1|
Sequence length 209
Comment copper homeostasis protein [Streptococcus pyogenes NZ131]
Sequence
MIKEFCAENLTLLPTLDAGQVSRVELCDNLAVGGTTPSYGVIKEACQLLHDKKISVATMI
RPRGGDFVYNDLELKAMEEDILKAVEAGSDALVLGLLTTENQLDTDAIEQLLPATQGLPL
VFHMAFDHIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDNVEQLKSLVTYANKRIEI
MIGGGVTAENCQSLSQLTGTAIVHGTKII
Download sequence
Identical sequences A0A0H3BWY9 A0A2J9PDN9 U2W7E7
gi|525809240|ref|YP_008242651.1| 160491.SpyM51522 471876.Spy49_0332c gi|139474330|ref|YP_001129046.1| gi|209558891|ref|YP_002285363.1| WP_009880724.1.20146 WP_009880724.1.23345 WP_009880724.1.23784 WP_009880724.1.24256 WP_009880724.1.24700 WP_009880724.1.24771 WP_009880724.1.26216 WP_009880724.1.27096 WP_009880724.1.29494 WP_009880724.1.35136 WP_009880724.1.35339 WP_009880724.1.36559 WP_009880724.1.3764 WP_009880724.1.38004 WP_009880724.1.39245 WP_009880724.1.40473 WP_009880724.1.41146 WP_009880724.1.44171 WP_009880724.1.49019 WP_009880724.1.51270 WP_009880724.1.51729 WP_009880724.1.52414 WP_009880724.1.54994 WP_009880724.1.57973 WP_009880724.1.59971 WP_009880724.1.60269 WP_009880724.1.65801 WP_009880724.1.6624 WP_009880724.1.66344 WP_009880724.1.68539 WP_009880724.1.69171 WP_009880724.1.87245 WP_009880724.1.87861 WP_009880724.1.8796 WP_009880724.1.88361 WP_009880724.1.89166 WP_009880724.1.89421 WP_009880724.1.92390 WP_009880724.1.94988 WP_009880724.1.95380 WP_009880724.1.97489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]