SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312622429|ref|YP_004024042.1| from Caldicellulosiruptor kronotskyensis 2002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312622429|ref|YP_004024042.1|
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.48e-23
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 79-146
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 3.92e-18
Family C-terminal domain of arginine repressor 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312622429|ref|YP_004024042.1|
Sequence length 152
Comment arginine repressor, argr [Caldicellulosiruptor kronotskyensis 2002]
Sequence
MKSERQQKILEIIQNEDIETQEELVERLKALGYDVTQATVSRDIKELRLTKVLTETGKYK
YAVLSGPEANITEKLIKVFSESIVKYDTADNLVIIKTITGAAQGAAAAIDSLSWPEVVGT
IAGDDTIFIATKGSAAADKIVERIKAIISQGE
Download sequence
Identical sequences A0A2G6VCL0 B9MRY0 E4QAT1 E4S7T7 E4SBV0 G2PTI3
gi|312793517|ref|YP_004026440.1| gi|222529325|ref|YP_002573207.1| WP_013403283.1.1144 WP_013403283.1.12921 WP_013403283.1.20482 WP_013403283.1.22435 WP_013403283.1.28668 WP_013403283.1.33084 WP_013403283.1.45436 WP_013403283.1.58293 WP_013403283.1.61561 WP_013403283.1.61668 WP_013403283.1.70627 WP_013403283.1.71443 WP_013403283.1.77617 WP_013403283.1.78124 WP_013403283.1.9959 521460.Athe_1334 gi|344996008|ref|YP_004798351.1| gi|312622429|ref|YP_004024042.1| gi|312127604|ref|YP_003992478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]