SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312623244|ref|YP_004024857.1| from Caldicellulosiruptor kronotskyensis 2002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312623244|ref|YP_004024857.1|
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.51e-26
Family Anti-sigma factor antagonist SpoIIaa 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312623244|ref|YP_004024857.1|
Sequence length 102
Comment anti-sigma-factor antagonist [Caldicellulosiruptor kronotskyensis 2002]
Sequence
MNLDLKEKISENGVVIELKGELDIFSSPTLKDKLYSLIDTSSSDVIIDMNDVSYIDSTGL
GVFVGALKKSKQKGTNIVLKNLKPNVKKVFTITGLDKVFRIE
Download sequence
Identical sequences A0A2G6UBK4 B9MNN8 E4SH13
521460.Athe_0435 gi|222528458|ref|YP_002572340.1| WP_013431110.1.1144 WP_013431110.1.20482 WP_013431110.1.22435 WP_013431110.1.28668 WP_013431110.1.33084 WP_013431110.1.45436 WP_013431110.1.58293 WP_013431110.1.61668 WP_013431110.1.71443 WP_013431110.1.77617 WP_013431110.1.9959 gi|312623244|ref|YP_004024857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]