SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325982638|ref|YP_004295040.1| from Nitrosomonas sp. AL212

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325982638|ref|YP_004295040.1|
Domain Number 1 Region: 112-370
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00000000248
Family Purple acid phosphatase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325982638|ref|YP_004295040.1|
Sequence length 824
Comment hypothetical protein NAL212_2042 [Nitrosomonas sp. AL212]
Sequence
MGIERKFKRPVSWLAGRELLASLESILSYLLNGEKQDSRDWMFVEAITPPHCNDTEQEYW
FDYIADTGDGSRAVYNVAYLCMSGLWLKDEKITRGHPVSLSRTGEFNQRLPRGEFLFVGG
DTAYHAADIAALKERFQTPFNWAYEDIAVTTGEKIDQRPIYGIPANHDYYDALDGFNRQF
CHPIVQDIHPLVREQEDLTDPPLGLHGFRREQKSSYVWLNLPFGWRLWGLDSQASKMDKR
QQAFFVTQFCDKLTRDGSLFDENKKEEVQETLRNAIPDKLIVATPEPSTVFGKRATSHAA
MTELFLRLGLEPGFLQDGRLDHSKCRLDISGDVHHYERYWGNANENGEYSNYASVVAGGG
GAFLHPSHTDAGEIKKQSVYPAEMDSHREVTQRILNPWQIFLGGYAWLIGAMVGFITYFA
VTVPQSTWSLFELVPNNLRPVWGDQDVLARIQIALTLANTDATLSGYWIDLIYLLLFVAF
LIAWRLMSIPELLKVKYSASRDIWNRRLITFLIPVVLWLIPLLLLILEPGESTPPSFLAA
ILIGLSCVAGLLIFSLIRCYSDILFERSRIRKETWLDFIPLWVLSVMGIFYMAVGFLHYG
TYQASIMSFDLLVIVVWSLVILGLTAFPFFASDKLGVAKANIGKFLAIGFWHAILQISIP
VCLALYVDWASWLIICGAAIAITLIAGHLFTSQYFFREFSADVQKKIGQGLLIAWIVIGI
AVFFATMQGELVAVDASRLLMAFLSGAIFGCIWLGWYLAVSMAFNCHNNEAGGGARSEKF
RHMIRIKLTEDTLTGYVIGIDAPEKDISKATIRLVDVFTLQVKK
Download sequence
Identical sequences F9ZEX2
gi|325982638|ref|YP_004295040.1| WP_013647902.1.95231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]