SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521169901|ref|YP_008161252.1| from Serratia plymuthica S13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521169901|ref|YP_008161252.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.19e-109
Family FMN-linked oxidoreductases 0.000000000708
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-44
Family N-terminal domain of adrenodoxin reductase-like 0.00000541
Further Details:      
 
Domain Number 3 Region: 461-528,567-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.21e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521169901|ref|YP_008161252.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Serratia plymuthica S13]
Sequence
MSNYPHLLAPLDLGFTTLKNRVLMGSMHTGLEELPDGPERMAAFYAERAAAGVALIVTGG
IAPNEKGVVYRGGSTLSRRDQVDHHRIVTDAVHQAGGKIALQILHAGRYSYQPQPVAPSA
LQAPINPFAPTALSEAEIEQTIADFAHCALLAQQAGYDGVEVMGSEGYLINQFLVARTNQ
REDTWGGSFSNRMRFAVEIVRAVRQAVGREFILIYRLSMLDLVEDGSSWQEIEQLALAIE
QAGATLINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVRIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAAEGRADEINTCIGCNQACLDQIFEGKLTSCLVNPR
ACRETEMPLTMAEKPKKLAVIGAGPAGLAFATTAASRGHRVTLFDAADQIGGQFNIAKQI
PGKEEFHETLRYFRRQLALLEVTVKLGTQVEAADLAEFDEVILACGIVPRTPAIPGIDNA
KVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQHGVSSSLDQAEFNREWGIDGQLS
QRGGLAAQGPVAERGPRQIYLLQRKTSKVGEGLGKTTGWIHRASLLMRGVKMLNSVNYQR
IDEEGLHISRAEQESCLPVDTVIICAGQEPRRELQQPLLAMGKTVHLIGGADVAAELDAR
RAIDQGTRLAMAL
Download sequence
Identical sequences S4YN09
gi|521169901|ref|YP_008161252.1| WP_006328223.1.20703 WP_006328223.1.51785 WP_006328223.1.55341 WP_006328223.1.61654 WP_006328223.1.72308 WP_006328223.1.95373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]