SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521170681|ref|YP_008158270.1| from Serratia plymuthica S13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521170681|ref|YP_008158270.1|
Domain Number 1 Region: 124-362
Classification Level Classification E-value
Superfamily Colicin 1.57e-57
Family Colicin 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521170681|ref|YP_008158270.1|
Sequence length 364
Comment colicin-B [Serratia plymuthica S13]
Sequence
MSGGDGKDARGPTGGVNGGPTGLGGGPNVGHGGTLTDTINGVTMTFEGVHAIDSGSGIQW
GGGDSGKGNNGGSKSGASGRNALRSIPGHPNVVDGGQLTGDNRDKHLYYSRTENFVYSVS
IDRNGNEKGAFQVSRPKTNESDTRTSWAKGEEYRKSVAREQVRNYLNDEKNVLMEASGII
ADAGEKISNHISGQYKRYAGEIANNLRNFQGKTIRNYNDALASLNNIMSNPSMKVKQGDK
QALISAMKSVKASDLASRFGHFGKFFKAADLAIKADKIRDKAIEGYNTGNWAPLAYEIEA
MVLSGIVGAVALGLVTGILSLLALSALFTATITIAAAALIAYATSYIDAALAERFNNEVV
RPTN
Download sequence
Identical sequences S4YQ36
gi|521170681|ref|YP_008158270.1| WP_006324270.1.20703 WP_006324270.1.51785 WP_006324270.1.55341 WP_006324270.1.61654 WP_006324270.1.72308 WP_006324270.1.95373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]