SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|521166457|ref|YP_008157138.1| from Serratia plymuthica S13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521166457|ref|YP_008157138.1|
Domain Number 1 Region: 185-376
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.14e-82
Family GroEL-like chaperone, apical domain 0.0000000373
Further Details:      
 
Domain Number 2 Region: 7-134,406-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.53e-77
Family GroEL chaperone, ATPase domain 0.000000124
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 8.93e-25
Family GroEL-like chaperone, intermediate domain 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521166457|ref|YP_008157138.1|
Sequence length 548
Comment molecular chaperone GroEL [Serratia plymuthica S13]
Sequence
MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGI
DKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEG
TGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTV
ISEEIGLELEKATLEDLGTAKRIVINKDTTIIIDGNGEEPAIQGRVSQIRQQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI
RAASKLSDLRGVNEDQNVGIKVALRAMESPLRQIVLNCGEEPSVVANTVKAGEGNYGYNA
ATEEYGDMIAMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKSDAPDLGGAGGMGG
MGGMGGMM
Download sequence
Identical sequences S0A8N8 S4YDU1
gi|518646962|ref|YP_008136502.1| gi|521166457|ref|YP_008157138.1| WP_004952637.1.16783 WP_004952637.1.20703 WP_004952637.1.22336 WP_004952637.1.51785 WP_004952637.1.55341 WP_004952637.1.61654 WP_004952637.1.72308 WP_004952637.1.75780 WP_004952637.1.85867 WP_004952637.1.95373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]