SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312115702|ref|YP_004013298.1| from Rhodomicrobium vannielii ATCC 17100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312115702|ref|YP_004013298.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.97e-36
Family Ribosomal protein L6 0.0000574
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.6e-25
Family Ribosomal protein L6 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312115702|ref|YP_004013298.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Rhodomicrobium vannielii ATCC 17100]
Sequence
MSRIGKKPVPVPKNVTATVEGQTVTVKGPKGQLSLTLVDDVEVKLEDGAISVKPRTDSKR
ARSMWGMSRSLVENLVVGTTNGFSRTLEITGVGYRAAMDGKALKLQLGYSHDVLYAIPEG
INVVVPKPTEITISGIEKDKVGQVAAEIRGFRGPEPYKGKGVRYQGEYIQRKEGKKK
Download sequence
Identical sequences A0A037V0E4 E3HZT9
WP_013420568.1.77764 WP_013420568.1.83591 gi|312115702|ref|YP_004013298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]