SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383309784|ref|YP_005362594.1| from Pasteurella multocida subsp. multocida str. HN06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383309784|ref|YP_005362594.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily MtlR-like 5.62e-56
Family MtlR-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383309784|ref|YP_005362594.1|
Sequence length 172
Comment mannitol repressor protein [Pasteurella multocida subsp. multocida str. HN06]
Sequence
MQSVDPIYEKLNEATSIRGFITASVAIFDEAVDQLINRVFRKTDFAVKSVVDSLLSNSGP
LCDLSIRLKVLLGLGIIEHHVFSDISHFIEIKEKLNNDEKEYDFADLIIIDFIQQLSCQN
DKSLLNFPMEKDENPDSLLYQVKALRREKLIRSYLTLAITEIYEQLQIESPL
Download sequence
Identical sequences A0A1D7R3K6 V4NCK2
gi|383309784|ref|YP_005362594.1| gi|378773782|ref|YP_005176025.1| WP_005723216.1.10027 WP_005723216.1.10721 WP_005723216.1.11014 WP_005723216.1.1307 WP_005723216.1.14908 WP_005723216.1.17217 WP_005723216.1.17980 WP_005723216.1.18123 WP_005723216.1.20287 WP_005723216.1.21657 WP_005723216.1.22153 WP_005723216.1.2313 WP_005723216.1.23830 WP_005723216.1.24757 WP_005723216.1.26616 WP_005723216.1.26777 WP_005723216.1.27416 WP_005723216.1.27592 WP_005723216.1.29697 WP_005723216.1.30617 WP_005723216.1.34253 WP_005723216.1.35978 WP_005723216.1.36022 WP_005723216.1.39152 WP_005723216.1.3957 WP_005723216.1.40210 WP_005723216.1.40787 WP_005723216.1.41297 WP_005723216.1.41351 WP_005723216.1.41462 WP_005723216.1.41657 WP_005723216.1.41667 WP_005723216.1.42469 WP_005723216.1.42512 WP_005723216.1.42943 WP_005723216.1.44741 WP_005723216.1.45422 WP_005723216.1.47685 WP_005723216.1.4808 WP_005723216.1.50853 WP_005723216.1.51342 WP_005723216.1.52066 WP_005723216.1.53852 WP_005723216.1.55074 WP_005723216.1.57420 WP_005723216.1.57956 WP_005723216.1.58111 WP_005723216.1.58450 WP_005723216.1.58628 WP_005723216.1.58910 WP_005723216.1.59455 WP_005723216.1.60664 WP_005723216.1.61098 WP_005723216.1.61860 WP_005723216.1.62016 WP_005723216.1.6219 WP_005723216.1.65482 WP_005723216.1.65878 WP_005723216.1.66934 WP_005723216.1.70689 WP_005723216.1.73917 WP_005723216.1.74955 WP_005723216.1.75804 WP_005723216.1.80223 WP_005723216.1.80589 WP_005723216.1.80911 WP_005723216.1.86541 WP_005723216.1.87897 WP_005723216.1.88402 WP_005723216.1.89773 WP_005723216.1.90081 WP_005723216.1.90179 WP_005723216.1.90578 WP_005723216.1.91495 WP_005723216.1.92478 WP_005723216.1.93940 WP_005723216.1.94432 WP_005723216.1.94435 WP_005723216.1.95718 WP_005723216.1.9746 gi|386833766|ref|YP_006239080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]