SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317123235|ref|YP_004097347.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317123235|ref|YP_004097347.1|
Domain Number 1 Region: 84-275
Classification Level Classification E-value
Superfamily Rhomboid-like 3.27e-41
Family Rhomboid-like 0.0017
Further Details:      
 
Domain Number 2 Region: 21-50
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000824
Family B-box zinc-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317123235|ref|YP_004097347.1|
Sequence length 314
Comment rhomboid family protein [Intrasporangium calvum DSM 43043]
Sequence
MSDSGTGAQPPIAPGAGQQPAGPSVCPRHPDREAYVKCQRCGRPACPECQRPAAVGIQCV
DCVREAARTAPTTRTVFGGRPTDGRPIVTQAIIGICVVVFLVQWVSPGTTVDYAFAPSAG
WIEPWRFVTAMFLHAPRSLLHIGFNLYALFILGSYLEPLMGRARLAALYLISGIGGQVSV
LLFAGNPTIEGLFNGTDAAWATPVVGASGAIFGLFGALIVLNRHLGRSAAGMYGVLLING
VLGFVIPNISWQAHLGGFVTGLACAGAIVLFRRQRVRHLTWLALSAVLALLVVISVGKYL
TVPVEIRDLTAFRR
Download sequence
Identical sequences E6SEL9
gi|317123235|ref|YP_004097347.1| WP_013490942.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]