SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317124357|ref|YP_004098469.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317124357|ref|YP_004098469.1|
Domain Number 1 Region: 47-226
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.77e-43
Family Phosphoglucomutase, first 3 domains 0.00095
Further Details:      
 
Domain Number 2 Region: 308-442
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.22e-25
Family Phosphoglucomutase, first 3 domains 0.0042
Further Details:      
 
Domain Number 3 Region: 214-316
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.85e-19
Family Phosphoglucomutase, first 3 domains 0.0063
Further Details:      
 
Domain Number 4 Region: 447-532
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.19e-16
Family Phosphoglucomutase, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317124357|ref|YP_004098469.1|
Sequence length 562
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Intrasporangium calvum DSM 43043]
Sequence
MRTAASAPDLVQSARTWRDDDPDATTRAELDGLIDQVELGSAQSRLELADRFSGMLQFGT
AGLRGALGAGPNRMNRSVVIRAAAGLVAHLQAVGRPGAAPTVVIGYDARYSSDVFARDTA
AVVEGMGGRAILLPGPLPTPVLAFAIRHLDADAGVMVTASHNPPEDNGYKVYLGDGSQIV
PPSDREIAARIAAVPSVASVPRATEGWRTLDDSIVEDYISAIVTVVAPDSPRELSCVHTS
LHGVGHTTLATAFVRAGFRPPTPVGAQALPDPDFPTVRFPNPEEPGAIDLALELARSEAC
DLVIANDPDADRCAAAVLDPALGDWRMLRGDEVGALLGAHLVNRGVEPGDVFASSIVSSR
LLGAIAAAAGIRHEETLTGFKWISRVEGLRYGYEEALGYCVAPHLVRDKDGVSAALLLAE
LAATLKSQGRGLTDLLDDLAVAHGVHATDSFSVRVSDLAQSELLLRRLREAPVTSLAARD
VARMDDLSLGLGALPPTEGLRYHLDDASRIIVRPSGTEPKVKIYLEVIEPVPDRAGLREA
QAAAAGRLATIRSELEQLTALP
Download sequence
Identical sequences E6SFJ7
gi|317124357|ref|YP_004098469.1| WP_013492058.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]