SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317124555|ref|YP_004098667.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317124555|ref|YP_004098667.1|
Domain Number 1 Region: 86-280
Classification Level Classification E-value
Superfamily Formyltransferase 5.36e-61
Family Formyltransferase 0.00038
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000999
Family SP0238-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317124555|ref|YP_004098667.1|
Sequence length 280
Comment formyltetrahydrofolate deformylase [Intrasporangium calvum DSM 43043]
Sequence
MARHIMTLTCDDRPGIVAAVSTALLDVNANIVENQQFSDEDTNLFFMRTVFDAAQDEVQT
VLDAIDRSAAVEHQHLAVRPADERCRTLILVSRFDHCLLDLLYRWKSGDLPIDIVGVVSN
HEDTRGLVEYYGVPFTHLPVTKETKAAAEAELLRLVAAQDVGLVVLARYMQILSDDLCQQ
LAGRAINIHHSFLPGFKGAKPYHQAHERGVKLIGASAHYVTGDLDEGPIIEQDVVRVTHA
ETPERLVAIGRDVERRVLSRAVRDHAESRVFLSGRRTIVF
Download sequence
Identical sequences E6S7N3
gi|317124555|ref|YP_004098667.1| WP_013492256.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]