SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317125525|ref|YP_004099637.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317125525|ref|YP_004099637.1|
Domain Number 1 Region: 25-236
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.06e-48
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 2 Region: 307-450
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-32
Family Phosphoglucomutase, first 3 domains 0.0032
Further Details:      
 
Domain Number 3 Region: 436-547
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 7.59e-20
Family Phosphoglucomutase, C-terminal domain 0.006
Further Details:      
 
Domain Number 4 Region: 210-318
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000471
Family Phosphoglucomutase, first 3 domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317125525|ref|YP_004099637.1|
Sequence length 548
Comment phosphoglucomutase, alpha-D-glucose phosphate-specific [Intrasporangium calvum DSM 43043]
Sequence
MTHARAGQPAQPEDLVDLDALLGAYYDRHPDPDNPDEQVAFGTSGHRGSSLNTAFNEDHI
LATTQAICDYRADQGYDGPLFLGRDTHALSEPAWRSALEVLVANGVTVLVDDRDGYTPTP
AVSHAILRANRGKGVQGSGLADGIVVTPSHNPPADGGFKYNPPNGGPADTDATSVIAARA
NELIHGGLRDVQRVPYDRARASSAAYDFLGTYVDDLPAVVDLARIKEAGVRIGADPLGGA
AVAYWGEIAERHGIDLTVVNPRVDPQWAFMTLDWDGKIRMDCSSPSAMASLIRTKDAYDI
STGNDADSDRHGIVTPDGGLMNPNHYLAVAIQYLYGGARPDWGATTAIGKTVVSSSMIDR
VATDLGRTLLEVPVGFKWFVPGLLDGSVGFGGEESAGASFLRFDGTVWSTDKDGIILALL
ASEILASTGRTPSQLYADLAERHGAPAYARIDAPASREQKAKLSALAASDVSADTLAGEP
ITAKLTEAPGNGARIGGLKVVTESAWFAARPSGTEDVYKIYAESFRGADHLARVQAEAKD
VVDAALGG
Download sequence
Identical sequences E6S6C1
WP_013493224.1.66196 gi|317125525|ref|YP_004099637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]