SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317125635|ref|YP_004099747.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317125635|ref|YP_004099747.1|
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-30
Family Phosphoglucomutase, first 3 domains 0.00035
Further Details:      
 
Domain Number 2 Region: 296-382
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.89e-27
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 3 Region: 161-269
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.53e-26
Family Phosphoglucomutase, first 3 domains 0.00017
Further Details:      
 
Domain Number 4 Region: 386-473
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.44e-16
Family Phosphoglucomutase, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317125635|ref|YP_004099747.1|
Sequence length 486
Comment phosphomannomutase [Intrasporangium calvum DSM 43043]
Sequence
MPRLSDFVKAYDVRGLVPEQLSNEVAHALGVAFAEVVARPDGKGGVVIGHDMRPSSPPLS
AAFADGVAERGLDVTMVGLCSTDGLYYASGALDVPGAMFTASHNPASYNGIKLCRAGAKP
VGQDTGLVEVRDLAQWLLDGRSGLPASPSGRGTVEARDLLADYSAFLRGLVDLSGSRRLR
VVVDAGNGMGGLTVPAVLGTAAGLPALPLEIIPLYFELDGTFPNHEANPLDPANLVDLQH
AVREHRADLGLAFDGDADRCFVIDADGEPVSPSAITGLVAAREIRRARAGGDRAVAVVHN
VITSAAVAEVVRENGATPIRTRVGHSFIKAEMARSGAVFGGEHSAHYYFRDFWFADTGML
AALHVLAALGEQGRPLAELARGYERYVASGELNSTVIDQDGVLERIRAWAVVRGASVDEL
DGVTVSSAGPTESMWWFNVRASNTEPLLRLNVEAADRETMARVRDELLELIRGKATSAGD
QQERPE
Download sequence
Identical sequences E6S786
WP_013493334.1.66196 gi|317125635|ref|YP_004099747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]