SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317126503|ref|YP_004100615.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317126503|ref|YP_004100615.1|
Domain Number 1 Region: 10-488
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.06e-204
Family Heme-dependent catalases 0.00000000000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317126503|ref|YP_004100615.1|
Sequence length 526
Comment catalase [Intrasporangium calvum DSM 43043]
Sequence
MSVEGPRQDPGNTKPLTTVAGAPVWDGENSVTAGPRGPMLLQDVWFLEKLAHFDREVIPE
RRMHAKGSGAYGTFTVTNDITQYSCAKIFAEVGKQTEMFVRFSTVAGERGAADAERDIRG
FAVKFYTEEGNWDIVGNNTPVFFFRDPLQFPDLNHAVKRDPKTNLRSAENNWDFWTNLPE
ALHQVTIVMSDRGIPASYRHMHGFGSHTYSFYNAEGERFWVKFHHRTQQGIKNLTDAEST
ALIGEDRESHQRDLFEAIENGDFPKWKLYVQVMPEADALKVPYHPFDLTKVWPKGDYPLI
EVGEWELNRNPENYHAEVEQAAFSPANVVPGISFSPDRMLQGRLFSYGDAQRYRLGVNHH
QIPVNAPKAAGTVNSPHRDGAMRIDAGATPAITPNSYGRYSSQPQYREPAWRIDPSADRF
NHREDDQDYYTQPGILFREKMTPEQQQALFENTARAISGASKETIERHIANCTKADPAYG
AGVRAAIDALNAAAAEADDVAKGAANANAPVDGAPVDRSDDMADLL
Download sequence
Identical sequences E6SF74
WP_013494200.1.66196 gi|317126503|ref|YP_004100615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]