SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317125007|ref|YP_004099119.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317125007|ref|YP_004099119.1|
Domain Number 1 Region: 463-586
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-18
Family Histidine kinase 0.018
Further Details:      
 
Domain Number 2 Region: 210-369
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000965
Family GAF domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|317125007|ref|YP_004099119.1|
Domain Number - Region: 15-112
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0981
Family Calcium ATPase, transmembrane domain M 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317125007|ref|YP_004099119.1|
Sequence length 599
Comment integral membrane sensor signal transduction histidine kinase [Intrasporangium calvum DSM 43043]
Sequence
MIHSPSGEPSSDGPPPPQPRTPLVSRRLRLVGIVLPVAGAVILELARYVLESRGYWSPGL
METWHVAMVMLVIGGIVVFALFMFRLIDDSERQIISQNRDLTTANAVAGAIQGQSTVSSI
IDGTLDAIVRSAGAVQARIRIFDTPGAADSETSTYTLVATPGLESSEHPSLDVPLTHGAV
TVGRLAMWYPDGVDPTERVGSSALSSLTTQVACAIQLAEAVADLNRRKIEGHALYDILLR
VSNQDPTTPVLDAVARHAMVRLHADGAAITLNPETASSVRFEAGPEAPTLRPDGTAVMAC
GTPVDARSSNRGRNGRTKEPAPQHTASKVVSGPAGPLGEITVARVAGSAFSERDCGFLST
LASLVGIALTGAQMRELSRQRAILNERTRIAREMHDSLAQVLGAVHLRLRALGATYASLP
QDQVAEEIDSLAEVCAESYRDVRETILGLRDSHQHAERSLEDNLRAYLTKYSSQSGIAAT
LINEVGHEVSLSPRAEVHLIRVVQEALTNVRKHAHASSVTVSVNGTDTSTSFAIEDDGVG
FDPVHTASAQDGYGLFTMRDRAALLGGTVDIDSVLGRGTRIMVTVPERPFAPRAVGSTR
Download sequence
Identical sequences E6SBA4
gi|317125007|ref|YP_004099119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]