SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313679063|ref|YP_004056802.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313679063|ref|YP_004056802.1|
Domain Number 1 Region: 162-328
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.3e-44
Family Histidine kinase 0.0007
Further Details:      
 
Domain Number 2 Region: 584-706
Classification Level Classification E-value
Superfamily TPR-like 2e-20
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 3 Region: 101-172
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000049
Family Homodimeric domain of signal transducing histidine kinase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313679063|ref|YP_004056802.1|
Sequence length 779
Comment histidine kinase [Oceanithermus profundus DSM 14977]
Sequence
MPRVTVQTLAEILRALRPHLGQPNFPHALYRALREHVSRRAAVAVEDLRFPDPPPQEAPR
LVEAEVRVWWPDGHPPALEELLRTLIRAHATIGDLRGELLAIEDQSSRSARMLSVLAHEI
KNPLFAVLGSLELLTQRGLEAEVHKLIETAHTSAQRMHALVNDSLQLVALEQEGVRLKAE
RLSLNGLLEELAGEVEPVALASGVHLRVVPLRGDAELLGDRRWLLQALLNLALNAVKYTP
EGGRVVLRAVADGTRVGLQVEDTGPGIAAGDLERIFEPFQRADTKKEGSGLGLAIVKRVV
EAHGGEVRVESQAGRGSRFRVELPRLLPGRRGGAGLGLRVLVLTAVAGLILARFPLFPVP
VEADTPQGRVALVQERALPQGGTVRLGSARLRFDPGSRAQVSARRSLWGGALSAAVRLPA
GGVAVRRDGAAPRLDLNLNRARLTPRGTDFLAQSGEVDRISLYDGRLALAAPGFQGELAP
GEGAVVSADGVEKRRLLAAPQVRLRTLDDGRLELRWLPVEGAVRYRITLLAGGVPVQVAE
VDAAPWVYEPQQDRSLTVQVQALDDLGLAGAPSPARPYEERGSFYRGHQSFVAGDYAAAA
ELLARALERDPAQPAAWLEYGLASLRLGKGAAAREALERALQLEPGYEARVLLPLAEALE
AQGDLEGAAAYYRRARSRQELSREATLGLIRAYLKLGRYDAAETAACTWLAGRPDDADAA
ELLRRALDGAGKAYAEPGCPLFQKPAPKPAPPPPPPRPEPKPEPEPPPPPPQQCNPFCN
Download sequence
Identical sequences E4U5S1
gi|313679063|ref|YP_004056802.1| WP_013456799.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]