SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313679284|ref|YP_004057023.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|313679284|ref|YP_004057023.1|
Domain Number - Region: 297-407
Classification Level Classification E-value
Superfamily TPR-like 0.0607
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313679284|ref|YP_004057023.1|
Sequence length 412
Comment hypothetical protein [Oceanithermus profundus DSM 14977]
Sequence
MVRIPSLPGVGAALTPALIVPAFAQGAPAAGPVTGLLAAALLLLAAGLFAVRKDPRDPAA
PVIPRFRPPEGVSAALAAYLGDRSVTARVFAAAVAELAARGFVNVVGGPKPRIDRAPGPP
ETSPPLELRALLEALVPRRRPQIELGRENGETLLLARSELGRNLAKAAAPYLRPNGAAVG
AVTVLASLALALAARLAYGHADAALLAGFFTLGYVFFGAQALQAAALGWERHRRVPGLAR
PRELARAGAGLLLVLLAALLGGLGLGLAAGAPAGALATALLLVAAWGARSLPALTREGAE
AWRHLEGLARYLGTTDAAELRRIEAPEDTPETLRALYPYAVALGVESAFARRLERYLSVH
PEEVQAAMLWDTTAESYPRMVGLYTYSLGVSRALHNAYQQAGAYTPELPGGR
Download sequence
Identical sequences E4U629
gi|313679284|ref|YP_004057023.1| WP_013457020.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]