SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313679647|ref|YP_004057386.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313679647|ref|YP_004057386.1|
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.04e-35
Family Nqo15-like 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313679647|ref|YP_004057386.1|
Sequence length 126
Comment NADH dehydrogenase (quinone) [Oceanithermus profundus DSM 14977]
Sequence
MSHAIYDAWVQLMGWLEEYAAEHDLVFDREADFPEFIYRMHKPWELPTRTMTVSLSRAND
EPFFVASVSQPSDEQKHVSLRSPGAHLHWHAHEHGGGLELSGGIKLDKTKLFALLDQARR
DWMTAV
Download sequence
Identical sequences E4U784
gi|313679647|ref|YP_004057386.1| WP_013457383.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]