SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313680127|ref|YP_004057866.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313680127|ref|YP_004057866.1|
Domain Number 1 Region: 37-282
Classification Level Classification E-value
Superfamily HCP-like 1.94e-40
Family HCP-like 0.021
Further Details:      
 
Domain Number 2 Region: 241-361
Classification Level Classification E-value
Superfamily TPR-like 1.23e-26
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313680127|ref|YP_004057866.1|
Sequence length 364
Comment tetratricopeptide tpr_1 repeat-containing protein [Oceanithermus profundus DSM 14977]
Sequence
MRKRSWIWLLTLTMAMIGSSWAQSEQAQPEQKEPSVKAYLLVGDVYYSSGEYDAAMIAFR
RALEKEPNNVYALYGLGRTQLKMHQFTAAIENLKRAIAIDGSYAPLYVALAQAYTDRYLY
AEDKTAAEKFLDQALLILDDARTIDPNYHAIYNQRGLVYQYKGELDKAEAAFKQALAIAP
DDAVVRYNLAQVYLSQGKLDEALDMLAQGVALDPASAQLQLLYGKVLAVKGRLVEAEQAL
AKATELAPLNASTWLNLGQVYYLEKKFAEAIDTLDKAIELDPLGFPEAYFYLGRSHLEAG
HVDDARLNLTKAIKLAPDNADYHYWLARALIAAGENDAARTELERALELAPNHQEAKKAL
SALK
Download sequence
Identical sequences E4U8L3
WP_013457863.1.73382 gi|313680127|ref|YP_004057866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]