SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313680309|ref|YP_004058048.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313680309|ref|YP_004058048.1|
Domain Number 1 Region: 121-258
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-16
Family GAF domain 0.011
Further Details:      
 
Domain Number 2 Region: 514-642
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000152
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Domain Number 3 Region: 420-509
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000595
Family PhoB-like 0.0043
Further Details:      
 
Domain Number 4 Region: 6-80
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000759
Family PYP-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313680309|ref|YP_004058048.1|
Sequence length 642
Comment pas/pac sensor protein [Oceanithermus profundus DSM 14977]
Sequence
MPLKRIRLDRNGRIVQASERALALLGLEPEAAVGRYCWDVVRGTDDFGRPVCTRCPVLAR
LRGGAYEAEVRLRVRGQRLRCQAIVQDSGVQVVLDERRRPKLGEVLFSLSWATQRMVDEP
MRFFQTAELFLGKLRRAAGMDAAELFLADPEHKYLILTALEAENRSAFLERPWFALGEGY
PGIVAVDRSPLVTHRLDEDERYLRLKVKEAGYRTYLVFPLELPQGVIGVLNLASKDPNAD
ESAALELLEAVAPVVAAGVYSVLTSMGERQLLALLRQSKLSDQDNDAVIESLLRSAMAFS
GAKAAQYKDRSGRRVAVPAQLTVNCDREDCPVWIGEPYAVRAGGRPCPWVEEGRPRYCLP
VVVQGEVVAVESIFFSRVPRPQTRAMAPLLWLQRMAWQLLGPRATAAEDAAAVPRLEVRA
LGALSVRLQGEALPPQRFQTLPWRLFKLFLAHPERVQTPEEIAEALWPDLDPAYAARRVA
RVVHELRKQIEPDAGAPRMLRSVEGGYLFRFTEGYAYDVERFEALIREADAQNDEGQALA
GYLAALDLFRGEFLADEPYADWVEAERAYLRALAVRAGERAGELLEAMGQEKASLSLYRR
LIAIDPSDPYLYDRLAAVLRSMGLEARAREIELRKQALLAGE
Download sequence
Identical sequences E4U945
WP_013458045.1.73382 gi|313680309|ref|YP_004058048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]