SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313680817|ref|YP_004058556.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313680817|ref|YP_004058556.1|
Domain Number 1 Region: 253-383
Classification Level Classification E-value
Superfamily TPR-like 0.0000000119
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 100-276
Classification Level Classification E-value
Superfamily TPR-like 0.000038
Family Tetratricopeptide repeat (TPR) 0.079
Further Details:      
 
Weak hits

Sequence:  gi|313680817|ref|YP_004058556.1|
Domain Number - Region: 353-448
Classification Level Classification E-value
Superfamily TPR-like 0.00986
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313680817|ref|YP_004058556.1|
Sequence length 451
Comment hypothetical protein [Oceanithermus profundus DSM 14977]
Sequence
MTPRIEEWLHQGEYDRAYDALVAAAERRFTTSARAAEALVDLAEFYSLYGEAEAEAWRAA
LDEAGARWPGVERNERYAALRFELEALAGQTLEPPPVEQPRAAYHVAQGLAYLGRMEAAL
EALPDPEVLPPFLEARAWALSGRVHESLGHLDAAARAHERAAGRSHGKERLWSLLDAAAL
WLETEAAEQAQTLLAEAEPLLGEGELSDRATYRYLRARVELLLGNPERAAEEIVQAEGLE
AAGAGLSHGTAMVRAQVHQRFGRLEAARAAYQDAEKRAAAGDLPFVWHEWGLFELDHGDL
IRAEALLRKVASDEAYPHRAHALADLAEAYYRLGDGAAADDAARRALELGTVPAAHLILG
NRAYDVGAWDEALAHYRAAAAAAREGDRDWVTATEMIVDVLAQTGYPNPAEVAELAERLL
PYLPPSDEWRETLRGYADRARELALKGRLLN
Download sequence
Identical sequences E4UA06
WP_013458553.1.73382 gi|313680817|ref|YP_004058556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]