SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313680837|ref|YP_004058576.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313680837|ref|YP_004058576.1|
Domain Number 1 Region: 84-222
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000212
Family Tetratricopeptide repeat (TPR) 0.083
Further Details:      
 
Domain Number 2 Region: 222-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000391
Family Extended AAA-ATPase domain 0.035
Further Details:      
 
Domain Number 3 Region: 691-833
Classification Level Classification E-value
Superfamily TPR-like 0.0000173
Family Tetratricopeptide repeat (TPR) 0.093
Further Details:      
 
Weak hits

Sequence:  gi|313680837|ref|YP_004058576.1|
Domain Number - Region: 238-264,513-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0452
Family RecA protein-like (ATPase-domain) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313680837|ref|YP_004058576.1|
Sequence length 871
Comment transcriptional activator domain [Oceanithermus profundus DSM 14977]
Sequence
MGGGWLPLAGRRRAAILAYLAVEGPSERTLLAEMLWGTEHAMRNLRVELHRLEQRFPGLV
VRRGSLLELGVDADVRAFEEALERADFARALDLYRGRLLEGAAAGVPPAFEDWLLIVRER
FEERYVDALVAQAERLAGRDPRAALALQRRVLERDPLREASCRAIMRLYAQLGEVRKALE
FYEGYADFLDRELQLPPVQATRRLAEELRTGKAQVRRWKRTPLAGREHELERMERAWREG
RHVILLGEPGIGKTRLLHEFARALGRRPLLLRGRPEDHAVPLATVARGLRVVLEQREPLP
DWARRELARVLPELGEPPSAPSPQRFLAAIGELLAPFDDADWFWGVDDLQFFDEGSLELL
MQLRSLGLTRPLAVAYRSGTLSPRAQTWIQSLVERQGAELVELEPLPPDAVARMFGDGAK
PEDAWVRALHRFTGGNPFFIVQLSESWRARGEPPEGASPALSDRLHALLRQRIGAVPARA
RSLLRLAAVAGEAYSPQLAGAVMGLAPLEVAEAADVLEYQGLFRRGRLAHDLVREATLRD
LDPETVRALHAQVAEQIKDRAAPGLVAAHYERAGMPERAVPLRLKAAAGAIRGFAYLEAF
EQFHRAFELSQGEARARLIAQTLITRYRIGVATGDWPRLERELDLTEAAARELGDAYTLK
NVQVGRVDLNFRRLDLDRAVRLGRQLLAEGGLTPDQEAMATYALAQALLFRDPDTHPEVA
RLCRRALELTDEDWYMWGWPFTTLALCCIKGGGLEEAEGWCAKAEAHFAAADDLAGLATV
QRTRALVAWWRGDAEAAAAAAERALELARKADFRTIVFMALDTAVGLYRALGDEARVRAL
TAEAERRGFRLERGDLWRLRLEPPLRPETLL
Download sequence
Identical sequences E4UA26
gi|313680837|ref|YP_004058576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]