SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313679180|ref|YP_004056919.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313679180|ref|YP_004056919.1|
Domain Number 1 Region: 696-881
Classification Level Classification E-value
Superfamily TPR-like 4.17e-22
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 
Domain Number 2 Region: 200-461
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-20
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Domain Number 3 Region: 591-722
Classification Level Classification E-value
Superfamily TPR-like 0.00000000491
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313679180|ref|YP_004056919.1|
Sequence length 927
Comment tetratricopeptide tpr_1 repeat-containing protein [Oceanithermus profundus DSM 14977]
Sequence
MRLRLLGSLELEGVRFTRPKPLLLLAYLALEGSRERRFLAELFWPEAKRPLGSLSVALTQ
LNKAHPGAVRTHGRRLYTPLPTDVDELIDAVARGEWARAVRLYGGAFAEGLDLRLGHELE
EWVFQMRERVAVWVARAHLELGHQALHRGAFDRARAHAEAAYALERAWGLSDPATTVELL
RKSGSPLLDDFVREHGRAEPVPCRVPRPVTRHLGRREELEAIERLLVREGQRWVTLVGLA
GVGKTRTAIEAAQRFCRRCYFADGVVWVELDADADADLPARIAEALKLTPDPRRLGWEDL
AARIDRRSVCIVLDGIERFHDQAGELARLVVRCPNLHLLATSRVRLGAAEERCLHLDGLS
VDPEVPGEPSPAVALFLERARRVHAALGEGTAAVEELCRVWQGHPLAIELAASWADLFPA
EELARRFSPPHLPRPRNGEGDLETLLEEAYEQLPSAARRVFPGLGVFEGGFDAEAATEVL
GADVGTLAVLSDRAMVWARNGRLGLHPLLRQLALRRLARRPGEEAEVRAAHARHYLDRLL
RHVQGLNRGDEPTLALMRNDHANLRAAWERAAAWGWHDRLAPLAEPLLRFFDRQGRFEEG
RRWFEAVLARAEDGGLRAPFALAAAWLWIRLGDLEAAERLMEGVAVGADPARNARLEQNR
GMLAYRRGDFAAAAEHWGRAAALAREGADPWARTAALQNRAIAVFSMGDHEAARRLFLEA
LATQEAHGHEADMAKTYNNLGNLLRVMGRSDEAERMLNQGLRRARRLGLGQIEPFLLYNL
GQLALASGRYVDALGRFEAALEGSRRSRERVLEASCQINLGLTSAHLQRWVEAERHLRQG
LAAAWRVGEAAEVARGLVVWARLELAQGDPRRACRLLRTALGLPELRAHNRREAENLMEA
LDPGACPGAPYRSAAEALEDLGVAAPA
Download sequence
Identical sequences E4U6K8
gi|313679180|ref|YP_004056919.1| WP_013456916.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]