SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313679248|ref|YP_004056987.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313679248|ref|YP_004056987.1|
Domain Number 1 Region: 7-244
Classification Level Classification E-value
Superfamily DAK1/DegV-like 4.97e-24
Family DegV-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313679248|ref|YP_004056987.1|
Sequence length 245
Comment degv family protein [Oceanithermus profundus DSM 14977]
Sequence
MAKDEIIGVVTDPGSSLTPEAARRKGVLLLDPTAPLEPQYRRLLEHFDRLLSLHASPELC
PMHDAAAEAAEGLADRVRVVDTRLGSAGLGAAALRAAEWIAHGADEKETLREVERLAREG
RFFLLTHDLSQLVENRMLPPLVGRFGQALGHWALIGLEKGRFQAPRPVRDAKLLSTIAGL
LKRRYGPVRLRVRATFGDLPEEVRGRLKEALARELHLEAGTLAPMDPVARMRVGDHALAV
FAYPV
Download sequence
Identical sequences E4U5Z3
WP_013456984.1.73382 gi|313679248|ref|YP_004056987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]