SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313681080|ref|YP_004058819.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313681080|ref|YP_004058819.1|
Domain Number 1 Region: 31-382
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-62
Family L-arabinose binding protein-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313681080|ref|YP_004058819.1|
Sequence length 395
Comment amino acid/amide ABC transporter substrate-binding protein [Oceanithermus profundus DSM 14977]
Sequence
MKITRRQLLQTGIGTAAAFGVPWFARAQARPVKLAALLPLTGPFAFAGNAALDAFRDATD
YVNEVMGGVGGRKLELIVEDTGYDVAKGTAAFNRVIGKESPEELLFVYGDSTGLSKALAP
EIARIGVPYSATSYSSELADPEKYPGIWVFGPTYSDMMEALLRYIHEKKPGARIALVHSN
SEFGRDPIPYVKKRAAQLGLPIVAEEVTPLVLSDATPTILKLRQAKPDFVLTQGYVLTAE
PLLVKTAREYGLNATFMGTYYSSEVILMKRAGPAADGFIATYHNAYSYDKSVPAVQEIYK
LRASKGKEPGYLTTFYMGAFFVGVAVGEAMRRAAAAGELTRPGITKALGKMWDYDAMGLI
HSMRFVNHRLPYTRLYRANAGKGIYEPLTDWLELA
Download sequence
Identical sequences E4UAE1
gi|313681080|ref|YP_004058819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]