SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377809774|ref|YP_005004995.1| from Pediococcus claussenii ATCC BAA-344

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377809774|ref|YP_005004995.1|
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily Formyltransferase 6.67e-62
Family Formyltransferase 0.00000564
Further Details:      
 
Domain Number 2 Region: 206-304
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.13e-25
Family Post formyltransferase domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|377809774|ref|YP_005004995.1|
Sequence length 319
Comment methionyl-tRNA formyltransferase [Pediococcus claussenii ATCC BAA-344]
Sequence
MKSIIFMGTPEFSAPILTSLIDAEEYNVIAVVTQPDRKVGRKHILTPSPVKKVAIQYDIP
VYQPEKLGGSEELEQLIDLHADLIVTAAFGQFLPMKLIDSVKIAAINVHASLLPKYRGGA
PVHYAIMHGEEETGVTIIYMVKKMDAGKMLAQESIDITKRDDVGTMFDKLSLLGRDLLLK
TLPALLDGSIEAKDQDENKVTFSPNIKPEEEQVDINLKASLVDDKVRGLRPFPGAFVYLN
GVRTKLWKVEVLEQKTNLEPGQVVKKTKHSLDIATGENGVISIEELQPAGKPKLTITDYL
NGSENAFIEGDQVIKYEEY
Download sequence
Identical sequences G8PDI4
gi|377809774|ref|YP_005004995.1| WP_014215516.1.45426 WP_014215516.1.84750 WP_014215516.1.85602 WP_014215516.1.96331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]