SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317054874|ref|YP_004103341.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317054874|ref|YP_004103341.1|
Domain Number 1 Region: 83-224
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.4e-29
Family PA2201 C-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317054874|ref|YP_004103341.1|
Sequence length 225
Comment hypothetical protein Rumal_0145 [Ruminococcus albus 7]
Sequence
MRDTLKPKEYFDQYIQKTSEGIQKFENGLSEGKYQADKILFIKDYILQKKIGIIIAKYSK
GDPLNDIKQEFDSTVELFCEAWDDSVYDSNIIYASLAYLLGLEADKLKSIKDKLQNADNY
DSLLEFILTGNKDNFDASKISFPKPYKNLVKSIEAEDREPFLKYLKGWYKGSKGSAWYGT
HELENKYCYNGYWSFESAAVAKRLGLNDSDLQNEQYYPYDLVHFN
Download sequence
Identical sequences E6UCB5
WP_013496901.1.49193 WP_013496901.1.63498 gi|317054874|ref|YP_004103341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]