SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317055933|ref|YP_004104400.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055933|ref|YP_004104400.1|
Domain Number 1 Region: 141-187,236-384,519-627
Classification Level Classification E-value
Superfamily Subtilisin-like 9.43e-56
Family Subtilases 0.003
Further Details:      
 
Domain Number 2 Region: 1236-1294
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000144
Family Type I dockerin domain 0.0023
Further Details:      
 
Domain Number 3 Region: 404-477
Classification Level Classification E-value
Superfamily PA domain 0.00000017
Family PA domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055933|ref|YP_004104400.1|
Sequence length 1299
Comment Lactocepin [Ruminococcus albus 7]
Sequence
MNKKSLQKLTGIVSAVAVGTSYILPAAALGTEKKAVYDDIVQVIVELYGDPVLAADKGDM
GADYLDTYAAKARVQQLENMRHNAFGEILSLYPDAELDFTYDAVFNGFACTLPRELIDEA
GKLSGIKDIMISKTNQIPSMQTYRELTGINKFCADTDITGKGKVIAVIDTELNLDHEMFS
AFEDDSFVKLTKDDIKNAVENRGLNFDIDPDSAYRSSKIPYAVSLINKDDRYAVGSDVEE
MFHGTHVCGIAAGNRVDPYDDGDMMSGAAPDAQLIFMAGFDYSPYFGPSIDDSVAVAGIE
DAVKLGADVVNLSFGQHCLSTDQEELYGTVLKNADNAGVVVCAAVGNSGTPESDPADVDR
SIIDTPGFLDDVFTVAATGVSFDLYNRMELADDTKVYCLASTTEEKHGKVKYEFVNCGSG
SKEEIEAHDVKGKLVLVENVSFRNDLYETELNAKKAGAAGVLLCSCDNDFHSENQLFDDP
DFIAIGTDLSGSKRVLAQTDHHIIVDLDEYTEHEIKGIADFSSIGSVQTLELKPEIAAPG
QGVLSASYDGYESMDGTSMATPFAAGCSALAAEYIENKGWKVSGSEKTALVKALLMNTAE
KVMLDDIPYSPRRQGAGMVDMNALGNCCVTMTNNGDASVCLGSMLGDEFSFDVTLHNYGD
KDVHFKSADLIMISESVEDDEFTYSPILTDKPAVLEHSAVFSTDDISVKAGSEMTFTVNV
TLDPDNVNTLDGIFKNGWFAEGYLTLSGAEYCSDISVPITGFHGDWNAAPIIGDDFIEGN
TEFMENVMKTPLLGNYLPASVSISEYLNAFMIEDFETASQKMDEATRHRYFISPNQDDIA
DIMCYNYFGKRTGILKKAYMTGQNGSIIPLLSYENPIYTQEASQIYLDPVYFAEDGDYTL
DLEMEPMHSDRDITAQKKSLGITVDTVPPSVSDIKIAEKGGRKILTIKAQDKHPEGIYII
GSSSGDNKGIPFDTVQTAINNLDPNSSIIPAGTGVGSVPKNRISSTDLFSFFDDVLYIQP
DKYDYDFFDALPAVPDENGCLTFSYDITDLSDYTITITDRGYNSVTYTENLPFVNSIPSS
QRIDKGTLLKDIKVPDHIYNGKIVSKGWEIYNEKTYEWEALPYNTRFTEKYNNRQIRYAV
RSEECENYSNPMLLLVNGVSLIKVTVYSDGQVIYCRDQFPSPMNMDLFYSWSPDPFSQIT
NNTEYRIEMEADGYVTRVMEFDGNNVPSDIDVYLNRLGDINGDGTLNVTDISKAAAHIKS
KRSIGEYEQVVADVNCDGKFNITDISKLAARIKGKKLFA
Download sequence
Identical sequences E6UDX9
gi|317055933|ref|YP_004104400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]