SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317056314|ref|YP_004104781.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056314|ref|YP_004104781.1|
Domain Number 1 Region: 11-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-54
Family PP-loop ATPase 0.0000534
Further Details:      
 
Domain Number 2 Region: 207-304
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000011
Family MesJ substrate recognition domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 354-437
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056314|ref|YP_004104781.1|
Sequence length 444
Comment tRNA(Ile)-lysidine synthetase [Ruminococcus albus 7]
Sequence
MKSDLSDRVRRTIEKYHMAEKGERLLIGLSGGADSAALLLCLHELGYDICACHVNHCIRG
EEADRDQHFCEELCKGLNIDITVKVVDVPAYCRANPVSEEEGARLLRYKALQEINADKIC
TAHNLDDCLETTLFNLARGSGLKGIASIPPVRENIIRPLIECSRADIEAYLFEKGQSFVT
DSTNLLDEYSRNKLRHKVVPVMREINPSLMDTFANTLGFLREDSRFLEKMSDDAFAEAVY
NDGFSCKMIRKLDYPIRRRVIMRILAKYDVEVSQDKIEMIEHLICNGGKISVKSNCFAYT
KSDTLYIYSENSDLKICSDDQVKVSEGVIYWQGRNIEFRIIEIDGKFENVNKKFANSCLD
YDKIKGVIVLRKRRAGDRIRLVNREHSSDVRVLMKQAFPLHKRDSAVLLADDEGIVLAEN
FGAADRVRIDSTTRRVLTYEVISE
Download sequence
Identical sequences E6UI86
WP_013498312.1.49193 WP_013498312.1.63498 gi|317056314|ref|YP_004104781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]