SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317056468|ref|YP_004104935.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317056468|ref|YP_004104935.1|
Domain Number - Region: 40-104
Classification Level Classification E-value
Superfamily PA domain 0.0144
Family PA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317056468|ref|YP_004104935.1|
Sequence length 149
Comment hypothetical protein Rumal_1803 [Ruminococcus albus 7]
Sequence
MRIFIDADGCPVVRLTLDIAKKHEIPVTIVCDTAHEFSRYDAEVITVDKGADSADFALVN
LMEKGDIAVTQDYGLAAMCLAKKAYAINQNGLVYNSDNIDSLLMSRHIAKKLKRSGNHLK
GPAKRTSDNDKKFVAALENLITETFGKDG
Download sequence
Identical sequences E6UA79
WP_013498465.1.49193 WP_013498465.1.63498 gi|317056468|ref|YP_004104935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]