SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317056656|ref|YP_004105123.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056656|ref|YP_004105123.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily YheA/YmcA-like 5.23e-18
Family YmcA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056656|ref|YP_004105123.1|
Sequence length 136
Comment hypothetical protein Rumal_1996 [Ruminococcus albus 7]
Sequence
MNVIELTRQLGKAIQEDERYKKYEAACALNDTDTEIQNEIGKFNQMRQDLSVEMRKPDKD
ADRLTTLDHDIKELYEKIMAMPKMVEYNEAKADIDALMKSVYYILQQSANGEDPETCPAQ
APSGCSGSCSTCGGCG
Download sequence
Identical sequences E6UAR7
gi|317056656|ref|YP_004105123.1| WP_013498649.1.49193 WP_013498649.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]