SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319788965|ref|YP_004090280.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319788965|ref|YP_004090280.1|
Domain Number 1 Region: 24-117,250-467
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.07e-91
Family Bacterial dinuclear zinc exopeptidases 0.000000813
Further Details:      
 
Domain Number 2 Region: 118-249
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.46e-31
Family Aminopeptidase/glucanase lid domain 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319788965|ref|YP_004090280.1|
Sequence length 469
Comment peptidase M18 aminopeptidase I [Ruminococcus albus 7]
Sequence
MAEKKKSAAEELAEKLLSQHKNGILRVDEKEIKDIDSYNEGYKDFLNTAKTEREAAEEIV
RQAEAAGFKAYERNKKYKSGDKFYFVNRGKAVILTVMGKKDISEGIRLAAAHIDSPRLDM
KQNPLYEDKEIAYFKTHYYGGIKKYQWPTVPLSLHGVIIKADGSTVKVRIGEDEGDPVFC
ISDILPHLAESQYKRPAPRLITGEELNIIVGSRPFKDDKISNKVKLNIMAILNEKYDIVE
DDLISAELEAVPAFKAVDVGFDRSMVGSYGQDDRVCAYSSLKAVLELKKPEYTCMTVLTD
KEETGSDGNTGLNSSYLPYFISDLAEVYGANGRNVMSKSECLSADVNAAVDPTFIEPFEV
RNCSQLNYGVVATKFTGARGKSGTSDASAEFVGRIRRLFDKNGIIWQTGELGKVDAGGGG
TVAQYIANLDLDVIDVGVPVLSMHAPFEITSKLDNYMAYKAFRVFFEDK
Download sequence
Identical sequences E6UL48
WP_013483931.1.49193 WP_013483931.1.63498 gi|319788965|ref|YP_004090280.1|NC_014825 gi|319788965|ref|YP_004090280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]