SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317055760|ref|YP_004104227.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055760|ref|YP_004104227.1|
Domain Number 1 Region: 314-334,371-610
Classification Level Classification E-value
Superfamily HAD-like 2.38e-62
Family Meta-cation ATPase, catalytic domain P 0.00051
Further Details:      
 
Domain Number 2 Region: 118-215
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.96e-24
Family Calcium ATPase, transduction domain A 0.007
Further Details:      
 
Domain Number 3 Region: 66-119,216-310
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000000314
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055760|ref|YP_004104227.1|
Sequence length 617
Comment heavy metal translocating P-type ATPase [Ruminococcus albus 7]
Sequence
MTKKQKNVLIRIIAAGALLITAALLPLEEKSLLRLAAFLVPYFVIGYDVLWKAVRGIIHG
QVFDENFLMCVATVGALFVGEYPEASAVMLFYQTGELFQSVAVGRSRKSISDLMDICPEY
ANVERDGQLEEVDPEEVELDSIIVIKPGEKIPLDGVIIEGSSSVDTAALTGESLPRSVKV
GDEVISGCINQGGLLKVKVTKEYEDSTVTKILELVENSATKKAKYENFITRFARYYTPSV
VIAAAVLAVLPPLILGGGWADWIHRALIFLVISCPCALVISVPLSFFGGIGGASKRGILV
KGGNYLEALANAETVVFDKTGTLTKGSFEVTKIHSDSMGEDELLDLAAHAESYSDHPIAR
SVCAKFGKEVDHGRITSDEEISGHGIRAVIDGREIYAGNKKLMAKQSVDVPECSCRGTMV
HVAADGGYAGHIVISDVVKETSAEAIKSLKENGVKQTVMLTGDAKSTAEEVANTLGLDKV
YAELLPADKVEKVEELLKEKQEGSSLVFVGDGINDAPVLTRADVGIAMGSLGSDAAIEAA
DIVLMDDDPAKISLAMKIARKTVRIVRENIVFALGVKALVLILGALGIANMWLAVFADVG
VSVIAILNAMRTMKIRS
Download sequence
Identical sequences E6UCI8
gi|317055760|ref|YP_004104227.1| WP_013497771.1.49193 WP_013497771.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]