SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357385458|ref|YP_004900182.1| from Pelagibacterium halotolerans B2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357385458|ref|YP_004900182.1|
Domain Number 1 Region: 200-331
Classification Level Classification E-value
Superfamily CBS-domain pair 4.15e-25
Family CBS-domain pair 0.0049
Further Details:      
 
Domain Number 2 Region: 344-427
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.82e-23
Family CorC/HlyC domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357385458|ref|YP_004900182.1|
Sequence length 430
Comment hemolysins-related protein containing CBS domains [Pelagibacterium halotolerans B2]
Sequence
MIEITIVAGLILLNGVFAMSELAVVSASKPLLRSMAERGQPGASAAVQLADDPGRFLSTV
QIGITLIGIIAGAFSGATIGGMLTGILLDAGLTGPAASALGYGGVVAIITYLSVVVGELV
PKQLALRSPERVACLVAPPMRILSRVAGPVVWLLDASTRLIFRLLGLSETNEEQVTEEEI
KSIVAEAAESGVIERDEKRMIAGVLRLSDRRARSIMTPRTDVEMLDFDDDFETIRTELAR
ARHSRLPVSSGEFDNIIGVLVVRDYLAAQPADHAALKKLLRKPQIVPDTLGALDVLNLLR
RADFPLALVLDEYGHFDGIVTPTDLLEAIAGVFRSDLEEGETDEAVQREDGSWLLAGGLM
VDDLSDRLGLVLPEHRDYQTLAGFIIDRLQHLPRTGEVLEAGNWRLEVVDMDGHRVDKVL
AIPREPAATQ
Download sequence
Identical sequences G4R952
WP_014131581.1.52817 WP_014131581.1.81790 gi|357385458|ref|YP_004900182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]