SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357385941|ref|YP_004900665.1| from Pelagibacterium halotolerans B2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357385941|ref|YP_004900665.1|
Domain Number 1 Region: 198-342
Classification Level Classification E-value
Superfamily CBS-domain pair 8.14e-31
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 339-418
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.02e-23
Family CorC/HlyC domain-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357385941|ref|YP_004900665.1|
Sequence length 425
Comment Co2 transporter containing CBS domains [Pelagibacterium halotolerans B2]
Sequence
MSLWLSLLAIIALLALSFFFSGSETALTASSRARMYQLAKSGNKRASLVEKLTAEKERLI
GAILLGNNVVNILASTLAASVLIQIFGEAGIAYATLAMTAAVVVFSEVLPKTLALIRPDG
FALVVAPVIRVIVLVFSPVTLAVQALVNLILRLFGLDPDKASDISGHEELRGTVDFLHSE
GEVVKGDRDMLGGILDLRELEVSDVMVHRTRMLALDADMPTDELIGAILDSPFTRVPLYK
DKQDNIIGVVHAKDLLRAIQKADGDFTRVNPARIAFKPWFVPDTTSAQAQLNAFLKRKLH
FALVVDEYGEVQGLITLEDILEEIVGEIADEHDAVIDGVRKQADGSYIVDGQLPIRDLNR
ALDWNLPDEEATTVAGLVIHEAKLIPDPGQQFTFHNLRFKVLRRQHNRVTQLRISPVEMA
VSAKG
Download sequence
Identical sequences G4REY2
gi|357385941|ref|YP_004900665.1| WP_014132062.1.52817 WP_014132062.1.81790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]