SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688203|ref|YP_004207937.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688203|ref|YP_004207937.1|
Domain Number 1 Region: 42-423
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-110
Family AAT-like 0.00000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322688203|ref|YP_004207937.1|
Sequence length 444
Comment aspartate aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MQKFSNMPLSEVASAAVPAARRVAVPTAKPASLSAEALNIPRSGIRDVFDRVERVPDAIS
LTVGEPSATAAPHIVAAACEAAQAGRTRYTNVLGVPEYRKAVADYSARVKGLTYDPETEI
QAVDGATIGLFLALKAVVGTGDEVIIPSPFFTSYDAEVMLCGGRPVTVALRPEHGMRVNA
ADIEAAITPRTRAVIINSPGNPTGAVTSAAELARIAEVCKQHNIWAISDEVYHPFVFGET
FGETLGGEAAVAPSIAAVPGMKDRTIVVESLSKTYAMTGWRIGYLLAPEAVIEQTGKIAE
LMHSSVNSLAQYAGVAALAGPQDHVAAMREEYRAKRQIVLDGLAGCPVLRLIEPQGAFYA
FVDVRLTGLDSGEFADRLLDEEHVAVVPGEAFGEEGRGFVRLSYAGDAGELREGVARLRA
FAERVWNPITGHHTATYHPMEVLA
Download sequence
Identical sequences A0A0A0UAU0 A0A0A1GPF5 A0A0M0VKJ1 B3DP11 D6DAY7 E5XXT2 E8MFY0 E8MWK6 I3AYT4 I3BLV7 Q8G6L2 R5NFZ6
205913.BLD_1425 206672.BL0628 gi|479136532|ref|YP_007768332.1| gi|322690205|ref|YP_004219775.1| gi|322688203|ref|YP_004207937.1| gi|23465211|ref|NP_695814.1| gi|189440287|ref|YP_001955368.1| NP_695814.1.18194 WP_007056527.1.12982 WP_007056527.1.15467 WP_007056527.1.22978 WP_007056527.1.29295 WP_007056527.1.35161 WP_007056527.1.35419 WP_007056527.1.37185 WP_007056527.1.37587 WP_007056527.1.41489 WP_007056527.1.42164 WP_007056527.1.4820 WP_007056527.1.49187 WP_007056527.1.50584 WP_007056527.1.50944 WP_007056527.1.51653 WP_007056527.1.51719 WP_007056527.1.51739 WP_007056527.1.55246 WP_007056527.1.55537 WP_007056527.1.56191 WP_007056527.1.59950 WP_007056527.1.61280 WP_007056527.1.62466 WP_007056527.1.68920 WP_007056527.1.76144 WP_007056527.1.76388 WP_007056527.1.8287 WP_007056527.1.83561 WP_007056527.1.89707 WP_007056527.1.94003 WP_007056527.1.94251 WP_007056527.1.94713 WP_007056527.1.96408 WP_007056527.1.98069 WP_007056527.1.98685 WP_007056527.1.99105 WP_007056527.1.99722 gi|312133621|ref|YP_004000960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]