SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688661|ref|YP_004208395.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688661|ref|YP_004208395.1|
Domain Number 1 Region: 18-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.46e-110
Family Cystathionine synthase-like 0.0000000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322688661|ref|YP_004208395.1|
Sequence length 394
Comment cystathionine gamma-synthase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MSAEYNAKFANTDIATRAIHAGQEPDPTTGAVVTPIFATSTFKQDGVLGLRGGHDYSRSI
NPTRTSFDEQLAAVEGGKYALSFSSGLAAIDVLLRSTIKPGDNILLGNDVYGGTYRLLSK
VFVPWGVGLDVVNITDLKAVETALASKHYQYVWVETPSNPLLNITDIAATTEVAHKYGTK
VAVDNTFASPALQHPLADGADVVVYSTTKYIGGHSDVVGGAVVVNDEETREKVAFLQNAA
GAVPSPFDSWLDIRGLKTLDLRVKRHSANALKVAEWLESQPSDVIERVWYPGLESHPGHE
IAARQMHGGFGGIVSVQLAAGAEAAKHFVDHTQIFTLAESLGGVESLIEVPAAMTHASVA
GTTLQVPANLVRISVGIENADDLIADLKQALDRI
Download sequence
Identical sequences A0A083XV86 A0A0A0UBT8 A0A0M3TJK5 A0A0S2MH82 C2GUQ8 E8MH72 E8MS73 F8AS95 Q8G565 V6XUU5
gi|322690647|ref|YP_004220217.1| gi|312133182|ref|YP_004000521.1| 206672.BL1155 gi|23465721|ref|NP_696324.1| gi|322688661|ref|YP_004208395.1| NP_696324.1.18194 WP_007053689.1.10685 WP_007053689.1.13888 WP_007053689.1.15467 WP_007053689.1.16764 WP_007053689.1.19800 WP_007053689.1.30534 WP_007053689.1.31269 WP_007053689.1.35161 WP_007053689.1.41489 WP_007053689.1.42164 WP_007053689.1.46548 WP_007053689.1.49397 WP_007053689.1.51719 WP_007053689.1.54925 WP_007053689.1.59950 WP_007053689.1.68920 WP_007053689.1.70526 WP_007053689.1.76144 WP_007053689.1.76173 WP_007053689.1.80315 WP_007053689.1.84493 WP_007053689.1.94003 WP_007053689.1.96408 WP_007053689.1.99105 gi|384201979|ref|YP_005587726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]