SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688715|ref|YP_004208449.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688715|ref|YP_004208449.1|
Domain Number 1 Region: 1-341
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.84e-81
Family AAT-like 0.000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322688715|ref|YP_004208449.1|
Sequence length 341
Comment hypothetical protein BLIF_0528 [Bifidobacterium longum subsp. infantis 157F]
Sequence
MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIREACGQPDADVWFLVG
GTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLTIPQHNGKMDPTELDEF
CKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVAHKYDMPLFVDGARLGYA
LTATGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNTPKHFLTLIKQHGALLAKG
FVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTLTFEAPTNQIFVTMDQPTID
RLEREVKLGFTEKADDTHTVMRICTSWATTHEEVDQLIELL
Download sequence
Identical sequences A0A0A1GM72 A0A0A6VMS1 C5E7Z3 D6D9G6 E8MSC7 I3ASL2
gi|322688715|ref|YP_004208449.1| gi|479136011|ref|YP_007767811.1| WP_007051204.1.10685 WP_007051204.1.11999 WP_007051204.1.13888 WP_007051204.1.15467 WP_007051204.1.30534 WP_007051204.1.31269 WP_007051204.1.37587 WP_007051204.1.41489 WP_007051204.1.49397 WP_007051204.1.50944 WP_007051204.1.54925 WP_007051204.1.55246 WP_007051204.1.55537 WP_007051204.1.70526 WP_007051204.1.76388 WP_007051204.1.80315 WP_007051204.1.8287 WP_007051204.1.98069 WP_007051204.1.99722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]