SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688761|ref|YP_004208495.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688761|ref|YP_004208495.1|
Domain Number 1 Region: 24-424
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.86e-115
Family GABA-aminotransferase-like 0.000000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322688761|ref|YP_004208495.1|
Sequence length 431
Comment acetylornithine aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MATEHEEKLGTEDSKWLGEYSQVHMNVFGTPLRVMDHGQGAHIWDVDGNEYLDFLAGIAV
NSLGYAHPKWVKAVADQAAKVAHISNYFASEPQIELASKLVKLAGAPEGSKVYFGNSGAE
GNEAALKLAKLYGRTLPGALPSIGGKPARILAMTHGFHGRTMGALSATWKPGIRKPYDPL
VPNIEFVRAGDKVALHDAFAQTGLGRYGKGPVAAVILELIQGEAGVQPLGADYVKFVREL
CDINHALLIIDEVQTGIGRTGKWFAFQRDDLSGGVTPDMVTFAKGVAGGFPMGGMIAFGE
KLAALFTPGSHGSTFAGNPLGAAAGLATLDVIEDENLVANAEARGEQLRDGIMATGNPLF
VSVRGRGLLDAVELKHPCSHAVMNYCLEHGLIVNAVAPNALRFAPPLIVTAQDVDQALAI
LKDVPTDLPDD
Download sequence
Identical sequences A0A083WZW8 A0A0A1GQH8 A0A0A6VMV6 B3DSZ0 E5XW85 E8MSH3 F8ARJ2 I3B5B8 P59315 R5MWF8
205913.BLD_0813 206672.BL1061 gi|312133077|ref|YP_004000416.1| NP_696233.1.18194 WP_007056889.1.10685 WP_007056889.1.11999 WP_007056889.1.12982 WP_007056889.1.15467 WP_007056889.1.16764 WP_007056889.1.22978 WP_007056889.1.23590 WP_007056889.1.26381 WP_007056889.1.29295 WP_007056889.1.31269 WP_007056889.1.35419 WP_007056889.1.37587 WP_007056889.1.46548 WP_007056889.1.4820 WP_007056889.1.49187 WP_007056889.1.49359 WP_007056889.1.50584 WP_007056889.1.50944 WP_007056889.1.51274 WP_007056889.1.51719 WP_007056889.1.51739 WP_007056889.1.54925 WP_007056889.1.55246 WP_007056889.1.59461 WP_007056889.1.59950 WP_007056889.1.61280 WP_007056889.1.70526 WP_007056889.1.76173 WP_007056889.1.76388 WP_007056889.1.86174 WP_007056889.1.89707 WP_007056889.1.94251 WP_007056889.1.98069 WP_007056889.1.99105 gi|189439676|ref|YP_001954757.1| gi|384201879|ref|YP_005587626.1| gi|23465630|ref|NP_696233.1| gi|322688761|ref|YP_004208495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]