SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688902|ref|YP_004208636.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688902|ref|YP_004208636.1|
Domain Number 1 Region: 8-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.86e-114
Family Cystathionine synthase-like 0.0000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322688902|ref|YP_004208636.1|
Sequence length 438
Comment O-acetylhomoserine (thiol)-lyase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MAENNKKYRFETLQLHVGQEQADPATDSRAVPIYQTTSYVFHNFDHAEARFGLADPGNIY
GRLTNSTQGVFEDRIAALEGGTAGLAVASGAAAVEYAVRNITQSGDHIVAAKNVYGGTFN
LLRHTLPRDGITTTFVSAENPQEFEDAIQENTKLVYFETFGNPNADLPDFEAITAIAHKH
HLPVIVDNTFASPYLFRPLEHGADVVVESATKFIGGHGTTLGGVIVEGGKFNWAEVPGKF
PTLTEPDPSYHGLNFYEALGGAAFVTRVRAILLRDTGATLSPFAAFLLLQGTETLSLRVE
RHVQNALKVIDYLKTVPEVESISHPSIEGRKDNELYKKYFPNGGGSIFTFDIKGGKDAAR
VFIDNLHLFSLLANVADAKSLVIHPASTTHSQETVEELEDQGIHQGTIRLSIGTENIEDI
LDDLKGGFEALRASGLAK
Download sequence
Identical sequences A0A0A0UCE9 A0A0S2MHR4 A0A1D7MTW1 C2GTR7 D6D916 E8MHV2 E8MSW4 I3B0W0 V6XVL7
gi|322688902|ref|YP_004208636.1| gi|479135861|ref|YP_007767661.1| WP_007053427.1.13888 WP_007053427.1.15467 WP_007053427.1.16764 WP_007053427.1.19800 WP_007053427.1.23590 WP_007053427.1.26381 WP_007053427.1.29295 WP_007053427.1.30534 WP_007053427.1.35419 WP_007053427.1.37587 WP_007053427.1.41489 WP_007053427.1.42164 WP_007053427.1.4820 WP_007053427.1.49397 WP_007053427.1.50584 WP_007053427.1.51739 WP_007053427.1.55246 WP_007053427.1.55576 WP_007053427.1.76388 WP_007053427.1.94251 WP_007053427.1.94713 WP_007053427.1.96408 WP_007053427.1.98069 gi|322690877|ref|YP_004220447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]