SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322688973|ref|YP_004208707.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322688973|ref|YP_004208707.1|
Domain Number 1 Region: 3-417
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.7e-109
Family Cystathionine synthase-like 0.0000000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322688973|ref|YP_004208707.1|
Sequence length 424
Comment aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MVDFKAIRAQFPILDQEIHGHPLVYLDSAATSQKPNAVIDAEANFYRTINAGVHRGAHEL
AARSTMAFEEARAKVAKLVGANAAEGEEEVVVTGGATAGLNLLATAFGNASLGRGGEAAK
RFALKPGDEIVVSRAEHHSVLLPFQELSYRTGATFKWIDLTEDGRVRTDNLDEVITERTK
VVAVTHVGNATGAITNIAPIIKRAHEVGSIFILDACQSVPHLKVDFHALDVDFAAWSAHK
MYGPTGVGFLYGKRDLLEALPPANFGGSMVELAYMDHEAQYMAPPARFEAGTQPVAQVVA
AGVAAEWMMNIGLENIEAHEKTIAAELLKLGDVDGIRILGPRENVDRIGTVAFDVAGVHP
HDVGQFIDAQGIAIRVGHHCAQPVHRHFGLYASNRASSGVYNSVEDAQALVEAAKGIRKF
FGVE
Download sequence
Identical sequences A0A083X0P3 A0A083XWB4 A0A0A1GRK0 A0A0M0VMG7 B3DSD0 C5EAP7 E5XXB4 E8MT35 I3AZE1 Q8G5Y2 T2I1Q3 V6XVM7
NP_696046.1.18194 WP_007052148.1.10685 WP_007052148.1.12982 WP_007052148.1.13888 WP_007052148.1.15467 WP_007052148.1.16764 WP_007052148.1.19800 WP_007052148.1.22978 WP_007052148.1.26381 WP_007052148.1.29295 WP_007052148.1.30534 WP_007052148.1.35419 WP_007052148.1.37587 WP_007052148.1.41489 WP_007052148.1.4820 WP_007052148.1.49187 WP_007052148.1.49359 WP_007052148.1.50944 WP_007052148.1.51719 WP_007052148.1.51739 WP_007052148.1.54925 WP_007052148.1.55246 WP_007052148.1.55537 WP_007052148.1.55576 WP_007052148.1.56191 WP_007052148.1.61280 WP_007052148.1.62466 WP_007052148.1.80315 WP_007052148.1.84493 WP_007052148.1.86174 WP_007052148.1.89707 WP_007052148.1.98069 WP_007052148.1.99105 WP_007052148.1.99722 gi|322688973|ref|YP_004208707.1| gi|189439466|ref|YP_001954547.1| 205913.BLD_0603 206672.BL0869 gi|312132874|ref|YP_004000213.1| gi|23465443|ref|NP_696046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]